PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G2041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 383aa    MW: 42096.2 Da    PI: 7.7318
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G2041genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-17120165147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W t Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
      Gh_A11G2041 120 RGHWRTAEDAKLKELVAQYGPQNWNLIAEHLE-GRSGKSCRLRWFNQ 165
                      899*****************************.***********996 PP

2Myb_DNA-binding52.61e-16172215146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r++++ eE+e+l+ a++ +G++ W+ I+r ++ gRt++ +k++w+ 
      Gh_A11G2041 172 RKAFSDEEEERLLSAHRVYGNK-WAMISRLFP-GRTDNAVKNHWHV 215
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.731115166IPR017930Myb domain
SMARTSM007171.3E-14119168IPR001005SANT/Myb domain
PfamPF002493.3E-16120165IPR001005SANT/Myb domain
SuperFamilySSF466891.61E-27120213IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-26121173IPR009057Homeodomain-like
CDDcd001671.40E-13123164No hitNo description
PROSITE profilePS5129424.973167221IPR017930Myb domain
SMARTSM007178.2E-14171219IPR001005SANT/Myb domain
PfamPF002492.7E-13172214IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-19174220IPR009057Homeodomain-like
CDDcd001677.08E-11174214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MSLPNLNNDF DCCSGVVKEM NFLAPPPILS PSVERDSTNP QMGFQIPSSL MEQHNKCLSF  60
EPLESRGTMR TAACDGKDGV LVVKKKGLAL NLGVEVDDVS NKNSGAVGGT KIGHTKLCSR  120
GHWRTAEDAK LKELVAQYGP QNWNLIAEHL EGRSGKSCRL RWFNQLDPRI NRKAFSDEEE  180
ERLLSAHRVY GNKWAMISRL FPGRTDNAVK NHWHVIMARK HREQSSFYRR RKPCSSSFAS  240
QAVPKGLDVT FQNNACSDQS TLSSNIDESA STCTDLCLTP SSAEVPLGFF SSFSPVLQMG  300
PSRTKENGDF GKLYGSGNVL YQQQGLMGVA NGVDQSTHSS DSEVTAAESV GTNKTNHSIE  360
SEDGNEKKIH NMRFIDFLGV GAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-351202207107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0527280.0KM052728.1 Gossypium hirsutum LOF-like transcription factor LOF4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492437.10.0PREDICTED: myb-like protein Q
TrEMBLA0A0B0PES80.0A0A0B0PES8_G
STRINGPOPTR_0019s05740.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.18e-71myb domain protein 105